

Product Information Product Name Growth Hormone Releasing Factor, GRF (1 - 29), amide, human Purity % Peak Area By HPLC ≥ 95% Molecular Weight 3357.9 Storage -20°C Sequence(One-Letter Code) YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 Sequence(Three-Letter Code) H - Tyr - Ala - Asp - Ala - Ile - Phe - Thr - Asn - Ser - Tyr - Arg - Lys - Val - Leu - Gly - Gln - Leu - Ser - Ala - Arg - Lys - Leu - Leu - Gln - Asp - Ile - Met - Ser - Arg - NH2 Description This hypophysiotropic peptide was isolated from human hypothalamic-hypophysial tissues. Within this 1 to 29 amino acid GRF fragment, amino acids 13 to 21 are more important than 24 to 29 for high affinity receptor binding. References Ref: Ling, N. et al. Proc. Natl. Acad. Sci. USA 81, 4302 (1984); Gaudreau, P. et al. J. Med. Chem. 35, 1864 (1992); Zarandi, VA. et al. Biochem. Biophys. Res. Commun. 119, 265 (1984); Lapierre, H. et al. Domest. Anim. Endocrinol. 4, 207 (1987); Mayo, KE. et al. Nature 306, 86 (1983); Pinski, J. et al. Peptide Protein Res. 41, 707 (1993).
Trustpilot
2 months ago
5 days ago
2 months ago
1 month ago